Loading...
Statistics
Advertisement

53511.mobi
www.53511.mobi/

53511.mobi

Advertisement
Conversion Technology Metas Server
53511.mobi is hosted in China / Beijing . 53511.mobi doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_547_1608221.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by 53511.mobi

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_547_1608221.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

CDN

Number of occurences: 1
  • CloudFront

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 53511.mobi

Missing HTTPS protocol.

    Meta - 53511.mobi

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 124.16.31.156
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • parkmydomain.vhostgo.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Tue, 11 Oct 2016 19:25:12 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=gs3nslfbah9v5jjf7367kqpdt1; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_hv1027 Transfer-Encoding: chunked Via: 1.1 s_hv1027 (squid/3.5.20) Connection: keep-alive

    DNS

    host: parkmydomain.vhostgo.com
    1. class: IN
    2. ttl: 2141
    3. type: A
    4. ip: 124.16.31.156
    host: 53511.mobi
    1. class: IN
    2. ttl: 900
    3. type: CNAME
    4. target: parkmydomain.vhostgo.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.3511.mobi, www.5e3511.mobi, www.e3511.mobi, www.5r3511.mobi, www.r3511.mobi, www.523511.mobi, www.23511.mobi, www.5t3511.mobi, www.t3511.mobi, www.533511.mobi, www.33511.mobi, www.5511.mobi, www.53q511.mobi, www.5q511.mobi, www.53w511.mobi, www.5w511.mobi, www.53e511.mobi, www.5e511.mobi, www.53511.mobi, www.5511.mobi, www.531511.mobi, www.51511.mobi, www.5311.mobi, www.535e11.mobi, www.53e11.mobi, www.535r11.mobi, www.53r11.mobi, www.535211.mobi, www.53211.mobi, www.535t11.mobi, www.53t11.mobi, www.535311.mobi, www.53311.mobi, www.5351.mobi, www.5351l1.mobi, www.535l1.mobi, www.535101.mobi, www.53501.mobi, www.535191.mobi, www.53591.mobi, www.5351.mobi, www.53511l.mobi, www.5351l.mobi, www.535110.mobi, www.53510.mobi, www.535119.mobi, www.53519.mobi,

    Other websites we recently analyzed

    1. Cogip.biz
      France - 37.187.171.164
      Server software: Apache/2.4.6 (CentOS) OpenSSL/1.0.1e-fips mod_fcgid/2.3.9 PHP/5.4.16 mod_perl/2.0.9dev Perl/v5.16.3
      Technology: Html, Iframe
    2. kiptom.com
      Brea (United States) - 75.119.203.215
      Server software: Apache
      Technology: CSS
    3. kineticwave.com
      Switzerland - 141.8.225.31
      Server software: Apache
      Technology: Html
    4. Clean Meals - Hoe gezond eet jij?
      Wij hebben de oplossing als je makkelijk en gezond wil eten: Clean Meals, heerlijke ready-made maaltijden in optimale samenstelling qua voedingswaarden.
      United Kingdom - 78.136.17.171
      G Analytics ID: UA-72057542-1
      Server software:
      Technology: BootstrapCDN, CSS, Datepicker, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery UI, Php, Pingback, Revslider, SVG, Google Analytics, Google Tagmanager, Visual Website Optimizer, Wordpress
      Number of Javascript: 35
      Number of meta tags: 9
    5. Lovely Jane macht Pause
      Germany - 85.13.136.199
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    6. huntingfishingcampinggearreviews.com
      Houston (United States) - 192.185.4.67
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    7. wherefarminggrows.com
      Scottsdale (United States) - 184.168.221.36
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. Britta Mangold . director of photography
      Dies ist die private Webseite von Britta Mangold
      Germany - 82.165.58.15
      Server software: Apache/1.3.33 (Debian GNU/Linux) FrontPage/5.0.2.2635 DAV/1.0.3 mod_python/2.7.10 Python/2.3.4 mod_gzip/1.3.26.1a PHP/4.3.10-18 mod_ssl/2.8.22 OpenSSL/0.9.7e mod_perl/1.29 mod_chroot/0.4
      Technology: CSS, Html, Javascript
      Number of Javascript: 5
      Number of meta tags: 4
    9. certifymybiz.com
      Scottsdale (United States) - 184.168.221.37
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. hajarbuncit.com
      Singapore (Singapore) - 54.251.110.33
      Server software: nginx/1.6.2
      Technology: Html

    Check Other Websites